Total number of results for Pseudis bolbodactyla are 7
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP02055 |
ASSSAQLKPFQRIDGTSDQKAVIGAMLAKYLQTRKAGSSTGRYAVLPNRPVIDPTHRINDRDYMGWMDF
|
69 | Pseudis bolbodactyla | Gastrin/cholecystokinin | Cholecystokinin-69 | 7925386#Johnsen AH#Identification of cholecystokinin from frog and turtle#Divergence of cholecystokinin and gastrin occurred before the evolution of amphibia Eur J Biochem 1994 Sep 1;224(2):691-702 | |
| NP02056 |
DLLASLTHEQKQLIMSQLLPELLSELSNAEDHLHPMRDRDYAGWMDF
|
47 | Pseudis bolbodactyla | Gastrin/cholecystokinin | Gastrin | 1633800#Johnsen AH, Rehfeld JF#Identification of cholecystokinin/gastrin peptides in frog and turtle#Evidence that cholecystokinin is phylogenetically older than gastrin Eur J Biochem 1992 Jul 15;207(2):419-28 | |
| NP03153 |
GFKEVLKAGLGSLVKGIPAHVAN
|
23 | Pseudis bolbodactyla | NA | Alyteserin-1Ma | 22800568#König E, Zhou M, Wang L, Chen T, Bininda-Emonds OR, Shaw C#Antimicrobial peptides and alytesin are co-secreted from the venom of the Midwife toad, Alytes maurus (Alytidae, Anura): implications for the evolution of frog skin defensive secretions#Toxicon 2012 Nov;60(6):967-81 | |
| NP03154 |
ILGAIIPLVSGLLSHL
|
16 | Pseudis bolbodactyla | NA | Alyteserin-2Mb | 22800568#König E, Zhou M, Wang L, Chen T, Bininda-Emonds OR, Shaw C#Antimicrobial peptides and alytesin are co-secreted from the venom of the Midwife toad, Alytes maurus (Alytidae, Anura): implications for the evolution of frog skin defensive secretions#Toxicon 2012 Nov;60(6):967-81 | |
| NP03155 |
GLLSVLGSVAKHVLPHVVPVIAEHL
|
25 | Pseudis bolbodactyla | NA | Caerin 11 | 16124032#Brinkworth CS, Bowie JH, Bilusich D, Tyler MJ#The rothein peptides from the skin secretion of Roth's tree frog Litoria rothii#Sequence determination using positive and negative ion electrospray mass spectrometry Rapid Commun Mass Spectrom 2005;19(18):2716-24 | |
| NP03156 |
SVSNIPESIGF
|
11 | Pseudis bolbodactyla | NA | Rothein 1 | 16124032#Brinkworth CS, Bowie JH, Bilusich D, Tyler MJ#The rothein peptides from the skin secretion of Roth's tree frog Litoria rothii#Sequence determination using positive and negative ion electrospray mass spectrometry Rapid Commun Mass Spectrom 2005;19(18):2716-24 | |
| NP03764 |
QSHISKARRPYIL
|
13 | Pseudis bolbodactyla | Neurotensin | Neurotensin | 1574601#Shaw C, McKay DM, Halton DW, Thim L, Buchanan KD#Isolation and primary structure of an amphibian neurotensin#Regul Pept 1992 Mar 5;38(1):23-31 |